PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00030320-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 79aa    MW: 9415.89 Da    PI: 11.391
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00030320-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19766357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++t++ql +Lee++++  r+p+a+++++++++l    +++ ++V++WFqN++ ++++
  WALNUT_00030320-RA  7 SRWCPTSKQLMILEEMYRSgIRTPNASQIQKITANLsfygKIEGKNVFYWFQNHKPRDRQ 66
                        8*****************99***********************************99996 PP

2Wus_type_Homeobox118.23.7e-38567264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        a++RW+Pt++Q++iLee+y+sG+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+k R+rqk
  WALNUT_00030320-RA  5 ASSRWCPTSKQLMILEEMYRSGIRTPNASQIQKITANLSFYGKIEGKNVFYWFQNHKPRDRQK 67
                        589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0036471IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-7766IPR009057Homeodomain-like
SuperFamilySSF466891.07E-10767IPR009057Homeodomain-like
PfamPF000463.7E-17766IPR001356Homeobox domain
PROSITE profilePS500719.5071267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MSPVASSRWC PTSKQLMILE EMYRSGIRTP NASQIQKITA NLSFYGKIEG KNVFYWFQNH  60
KPRDRQKLRR KVSRQQQLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016605.19e-43Homeodomain-like superfamily protein, putative
SwissprotQ9SIB49e-43WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A061H0611e-42A0A061H061_THECC; Homeodomain-like superfamily protein, putative
TrEMBLD7SKP42e-43D7SKP4_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g03780.t016e-43(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-44WOX family protein